Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. Reliable performance with a proven track record. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. Molecular Devices SpectraMax 384 Plus Microplate Reader. It. Minimum volume and maximum throughput with 96- or 384. The SpectraMax® M Series Multi-Mode Microplate Readers measure UV and visible absorbance, fluorescence, luminescence, fluorescence polarization, TRF and HTRF. to View Figures. Features demonstrated by the model include temperature control, a robot-compatible interface and data analysis software. Total volume (except deep. Wavelength Range. Hybrid optical system on the SpectraMax iD5 reader. SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. Published Dec 16, 2020 | Updated Dec 16, 2020. It measures the optical density (OD) of samples in both 96- and 384-well. Read one sample or up to 384 in a single plate read using any standard. 4 µL DNA standards. Wavelength Range. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. Keywords: fluorescence polarization. It is upgradeable to include a barcode reader,. Products : SpectraMax 340PC 384 (Obsolete), SpectraMax Plus 384 reader. 96 wells 384 wells Absorbance 0:30 1:40 Fluorescence intensity 0:25 1:25 Luminescence 0:30 1:15. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3. Supplier: Molecular Devices. 305 reference level saturation. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. These upright laboratory refrigerators will fulfill all general-purpose applications, with adequate space for ventilation. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 5 mP 6 mP * For properly functioning, operated, and maintained equipment. 96 / 384 Head: Fixed Pin Tool - 384 Head: Grippable Pin Tool - 96 / 384 Head: Magnetic Pin Tool - 96 / 384 / 1536 Head: LUMINESCENCE MICROPLATE. 313 reference gain check fail. Molecular Devices Spectramax Plus 384 Microplate Reader is available from The Lab World Group. ¨The SpectraMax M2 is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. SpectraMax i3x Multi-Mode Microplate Reader. The SpectraMax Paradigm Multi-Mode Detection. DNA provides the same sensitivity as a spectrophotometer. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 384 wells: Abs 49 sec. Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. 100 fmol 1536-well (8 µL) 0. Multimode Readers Comparison Chart. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. Flexible Throughput Read one sample or up to 384 at a time – it’s your choice. For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. ester flash assays, in both 96- and 384-well plates. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. When reading optical density at wavelengths below 340 nm, special UVtransparent, disposableFor SpectraMax ABS Plus reader, r 2 = 0. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. Customize data collection and analysis. 1. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell-based assays. !Pathchecklm1000. used. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Temperature control and shaking included as standard. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, FlexStation II (Obsolete), Gemini EM reader, FlexStation 3 reader. Get more information about Fluorescence Polarization SpectraMax Detection Cartridges, which offer great sensitivity for SpectraMax i3x and Paradigm Systems. Detection of species collected on membrane plates is also possible. Includes: Computer Loaded with SoftMax Pro 5. Clearance . The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. This kit is optimized for Molecular Devices384 wells, the SpectraMax iD3 reader is the complete solution for all your research needs. All SpectraMax® M series readers accept cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Products : General, Microplate Readers. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax 340PC384的光学设计真实地模 拟双光束分光光度计。每个孔有其各自的 样品光束检测和参比检测。8通道的系统, 包含8条样品检测光束和8条参比光束,给 予出众的精确度和高速读板方式。 不需要滤光片 SpectraMax 340PC384使用光栅单色器代替 滤光片。Explore more about Optimized settings for Transcreener TR-FRET assay on SpectraMax iD5 and SpectraMax i3x readers. SpectraMax iD5; SpectraMax Mini; SpectraMax Mini Install Guide; SpectraMax Mini Reader Plug-In Download Page (required for SoftMax Pro 7. 100 fmol 384-well (75 µL) 0. A microplate reader that can detect two or more applications is considered a multi-mode plate reader. Open the catalog to page 2. Note: Additional readers with similar performance are listed. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. SpectraMax ® Plus 384 optics. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Molecular Devices SpectraMax Plus 384. When connecting for the first time to either the SpectraMax L reader or StakMax system. The value for 1000 should be higher than the value for 900. Description: The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research. Validate the optical performance of your absorbance . The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . SoftMax® Pro Software for Windows 10 and 11 is designed to provide the simplicity, flexibility and power required for advanced data analysis. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Our microplateSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. It measures the optical density (OD) of samples in both 96- and 384-well. ® reader to the computer. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, SpectraMax Plus 384 reader, SpectraMax 190 reader, VersaMax reader, FlexStation 3 reader I need to reinstall the USB driver for my plate reader. Detection of species collected on membrane plates is also. Eight different automated tests are provided: • Absorbance accuracy (linearity) • Precision (reproducibility) • Stray light • Wavelength accuracy • Wavelength repeatabilityThe SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Wavelength optimization. 313 reference gain check fail. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and analysis. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. The PathCheck sensor can extend the instrument linearity by a factor of three or more. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v2. The SpectraMax® L Microplate Reader measures flash and glow luminescence assays in both 96- and 384-well plates. In the M2, M5 and Plus 384, the light. Other recommended products. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-ModeNote: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. SpectraMax® Absorbance Microplate Readers can run both cuvette-based and microplate reader applications on the same instrument. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. SpectraMax® iD5 Multi-Mode Microplate Reader - Five-Mode Hybrid Microplate Reader with Automatic NFC Filter Identification and Western Blot Capability, Molecular Devices. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Table 2. High sample correlation coefficients (R 2) make it easy to. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. . 1 Figure from 528 Publications Molecular Devices LLC. 0nm increments. E = absorptivity (extinction coefficient) C = concentration = pathlength. Microplate Readers. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. both cuvette-based and microplate reader applications on the same instrument. Reads standard cuvettes & 96-384 well plates from 190 to 1000 nm. These models can no longer be repaired. All data were generated from at least three independent experiments (n ≥ 3). SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. 2 SpectraMax MiniMax300ImagingCytometer(cytometer) 3. Annual recertification of your validation plates ensure that they meet specifications and give you confidence in the performance of your instrument. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. For more sample throughput, the system can be. no. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. Time Resolved Fluorescence. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. We would like to show you a description here but the site won’t allow us. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. Key applications**. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. 96/384-FortheSpectraMax340PC384,presstoselecttoreada96-wellplateora384-wellplate. SpectraMax Plus384, 190, 340PC384, and VersaMax User Guide Molecular Devices User Guide SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. The light should fall square on the slit. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. ester flash assays, in both 96- and 384-well plates. Used MOLECULAR DEVICES SPECTRAmax 384 Spectrophotometer For Sale - DOTmed Listing #2356563: Spectra Max Plus 384 Microplate Spectrophotometer - GOOD WORKING UNIT Equipment was recently removed. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. For more sample throughput, the system can be. Or scan up to 384 wells at any time to. The adapter isThe SpectraMax Paradigm Multi Mode Detection Platform utilizes a patent pending design that allows for real time system configuration by the user in less than two minutes. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. Molecular Devices, LLC. Every step is optimized for data acquired from a Molecular Devices microplate reader or data imported from. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. 003 fmol 0. Expanded dynamic range Engineered for performance with spectral fusion illumination for increased sensitivity across the entire excitation range. We would like to show you a description here but the site won’t allow us. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. Future ready The SpectraMax® i3x Multi-Mode microplate reader measures spectral-based Absorbance, Fluorescence, and Luminescence with the added functionality of modular. Clamp for injector 1 is on the left and clamp for injector 2 is on the right. Each SpectraMax® 340 PC 384 Microplate Reader has an. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. To rule out any nonspecific binding, an irrelevant human Fc-fusion protein control was used to test the hybridoma supernatants. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Microplates for applications that require high sample recovery rates. Perform the following steps to install the drivers: Start > Control Panel > System. , FI 15 sec. 2 pM 2 pM 384-well (50 µL) 3 pM 4 pMThe SpectraMax i3 Multi-Mode Detection Platform is a versatile instrument that can perform various assays and measurements on microplates and cuvettes. The Spectramax 190 has an array of data collection modes, including kinetic, endpoint, and spectral scan modes. The SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. Read one sample or up to 384 in a single plate eead using any standard cuvette, or 96-or 384-well microplate. Item SpectraMax Plus 384 Microplate Spectrophotometer. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. spr SpectraMax Plus 384. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. SpectraMax® Quant™ dsDNA Assay Kits The SpectraMax® Quant™ dsDNA Assay Kits are designed for fluorescence-based dsDNA quantitation across a broad range of concentrations. Note: In this user guide, all references to SpectraMax Multi-Mode. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. SpectraMax® Plus 384 provides ultrafast, full spectral range. Charge heterogeneity with fast and simple CZE or with hi-res cIEF. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Create custom fluorescence assays without having to purchase expensive filter sets. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 00 USD Tecan Infinite 200 Pro M Plex Microplate Reader - AV $14,995. , FI 45 sec. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Reads 96-well microplates in 5 seconds; Reads 384-well microplates in 16 seconds, Monochromator, tunable 1. Mode 96-well 384-well 1536-well Optimizedforspeed 12seconds 25seconds 50seconds Optimizedforperformance 20seconds 40seconds 80seconds Table1-1:PlateReadTimesforOn-the-FlyDetection(± 5. SpectraMax Gemini XPS/EM Register or Sign In. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Use preconfigured wash, soak, and aspiration protocols or create your own multi-step protocol using the simple touchscreen interface. Wavelength Selection. Read one sample or up to 384 in a single plate. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. You manually lift up the lid over the chamber to insert or remove a cuvette. Contact Information: Craig Adams. 305 reference level saturation. 190-1000 nm, tunable in 1 nm increments. Published Dec 16, 2020 | Updated Dec 16, 2020. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Detection modalities are shown in Table 1-1. Colorimetric assays. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Set up SoftMax Pro Software to use PathCheck as detailed above. 384-well: Abs 49 sec. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000 nm. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. SpectraMax M2, M2e; SpectraMax M3, M4, M5, M5e; FilterMax™ Multi-Mode Detection Platform. Use any standard cuvette, 12 x 75 mm testThe SpectraMax Mini Multi-Mode Microplate Reader is a budget friendly solution. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. The 190 can read across the entirety of the UV-Vis. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. 100 fmol 384-well (75 µL) 0. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. For nearly 30 years, Molecular Devices has provided scientists with . 8 in. Microplate Spectrophotometer. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 2. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. spectraMax 340pc 384 Microplate reader. Cables. 0200-6263. Our absorbance plate readers feature our PathCheck Sensor technology and. This integrated system. Download PDF versions of the SpectraMax Microplate Reader User Guides. If using a microplate, place it in the drawer of the SPECTRAmax PLUS, then read the plate. SpectraMax M series, Gemini, and SpectraMax iDx readers have xenon flash lamps,. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. Molecular Devices SpectraMax Plus 384. Beer-Lambert Law states that. spectramax, i3x, spectramax i3x, detection cartridge, spectramax i3x injector cartridge, smartinject technology, atp a, spectramax i3x multi-mode microplate reader, luminescent cell. reader in the visible range between 405–750 nm with NIST and NMI. AlphaScreen and AlphaLisa detection using a 680 nm excitation laser diode and a 570/100 nm emission filter. Absorbance Detection Cartridges combine scanning and broad spectrum wavelength range to address a variety of nucleic acids, proteins, ELISAs and immunoassays found in the laboratory. 6-, 12-,. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Please see part number 6007619, sterile,. SpectraMax™ Plus 384 VersaMax™The SpectraMax M2e is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. 2. ®Supplier: Molecular Devices. Capture flash assays with ease Expand your lab’s capabilities to include flash applications such as dual luciferase and ATP assays with the SpectraMax iD3 injector system with SmartInject™ Technology ensuring equal mixingThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. Shaker time 0 to 999 seconds Temperature control Ambient. Temperature control and shaking included as standard. 25 µL/well in a 384-well plate, using AlphaScreen Phosphotyrosine (PT66) Assay Kit 0200-7017. 384 wells) and the "Select Specific" menu to choose the specific plate type. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 3) This warranty covers the SPECTRAmax PLUS 384384-well clear-bottom, scintillating microplate for cell-based radiometric proximity assays. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). Experienced in operating and performing maintenance on numerous laboratory instrumentation from various large and small manufacturers including Spectramax 384 and i3 with Softmax software. Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. Wavelength(s): 230 to 750 nm (depending on model) Features: Shaking, Temperature Control. SoftMax® Pro Software is included and enables data visualized in 3D plots, gray scale, kinetic curve. The plate reader optics are. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 0200-6262. 5 mP. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. Data can be analyzed and combined from different plates. The minimum order for this item is . Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. The SpectraMax 340PC384 system has a monochromator instead of interference filters. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Digital controller and display. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. By using PathCheck, SpectraMax readers can automatically normalize sample absorbance values to a 1-cm pathlength and calculate the concentrations. The Molecular Devices SpectraMax M5E is a multi-mode plate reader that delivers single mode reader performance with five preferred detection modes for a wide range of applications. For more sample throughput, the system canMicroplate Spectrophotometers. Reads from 190 to 1000 nm range across various vessels. 100 fmol 1536-well (8 µL) 0. Use any standard cuvette, 12 xSpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. With the QuickSync client installed on your computer, your SpectraMax iD3 reader can push data to any computer within the same network. 384 wells < 45 sec. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. TheSpectraMax®Plus384addstheabilitytoreadcuvettes. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-Mode Molecular Devices SpectraMax Plus 384. 과 같은 Parameter를 검사하여 평가할 수 있습니다. tools to expand the. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. With optimized reagents, option to operate the. Before you do a bottom read, or use high profile (6-well, 12-well, 24-well, or 48-well) plates, you must remove the plate adapter from the plate drawer. both cuvette-based and microplate reader applications on the same instrument. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. Page 78 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. This kit is optimized for Molecular DevicesMolecular Devices Microplate Reader Spectramax 384 340PC. However, for greater flexibility, some instruments can accommodate 6- to 1536-well plate formats. Wavelength Selection: Monochromator, tunable 1. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. The SpectraMax Plus 384 Microplate Reader for absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on the. Temperature control and microplate-shaking included. Statistics. Also refer to this Multimode Reader Comparison Chart. Molecular Devices SpectraMax 340PC Microplate Spectrophotometer. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. SpectraMax 190 reads 96-well plates. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. 0 fluorometer; BioMicroLab – XL20 tube sorter; Biobus; Thermo Scientific – NanoDrop 2000 Spectrophotometer; Thermofisher – Qubit FluorometerSpectraMax® L和SpectraMax® M5酶标仪均为CellTiter-Glo检测提供了优异的检测灵敏度。SpectraMax® L化学发光读板机带有自动增益功能,能同时进行模拟信号和光子计数,提供大于9个数量级的动态范围,对于高信号值样品无需稀释,同时对于低信号样品具有优越的灵敏度。After 3× washing, the plates were developed with ABTS substrate (Moss) and analyzed on a SpectraMax Plus 384 spectrophotometer (Molecular Devices) at optical density (OD) 405 nm. Multimode Reader Comparison Chart. Technical specifications Detection limit for ATP Glow 0200-7012 (LUM) Optimized Guaranteed* 96-well (200 µL) 1. to View. 2. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. 96- or 384-well microplate compatibility. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. Vice President Sales and Marketing. It measures the optical density (OD) of samples in both 96- and 384-well. The . Multimode Reader Comparison Chart. For more sample throughput, the system can be. Cross-talk < 0. Abs 49 sec. Check Details. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. Fluorescence Intensity top and bottom capabilities. Which SpectraMax Multi-Mode Microplate Reader do you need? Detection Modes Absorbance Fluorescence Intensity Luminescence Time-Resolved Fluorescence Fluorescence Polarization HTRF Upgrade Options Plate Formats 6-, 12-, 24-, 48-, 96-, 384-Well Microplates Certification and Validation IMAP Validation (TR-FRET only) (TR-FRET. Page 6 SpectraMax Plus384, 190, 340PC384, and VersaMax Installation Guide Connecting Instrument Cables The power cord and USB cable connect to the ports on the rear of the instrument. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. For the reference reading, use the “0” standard. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. Shaker Time: 0 to 999 seconds: Temperature Range. Molecular Devices. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. , FI 45 sec. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The reader is ideal for measuring flash and glow assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) via aequorin, bioluminescence resonance energy transfer (BRET), and acridinium ester flash assays, in both 96- and 384-well plates. spr SpectraMax iD5 SpectraTest ABS2 v1. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Keywords spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software. 0 nm increments. formats from 6- to 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. Assay Kits. Wavelength Selection: Monochromator, tunable 1. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. 더 많은. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10 Multimode Reader Comparison Chart. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. Temperature control. ) 8. Tb donor/red acceptor. SpectraMax190reads96-wellplates. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Robust. 10822 512. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates.